PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596923.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 303aa    MW: 33965.9 Da    PI: 8.0953
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596923.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +++ +v+ +G g+W++I+++ g++R++k+c++rw +yl
   XP_013596923.1 14 KGLWTAEEDAKILAYVAIHGVGNWSLIPKKAGLNRCGKSCRLRWTNYL 61
                     678*******************************************97 PP

2Myb_DNA-binding52.31.3e-1669110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++++E+el++++++  G++ W++Iar+++ gRt++++k++w++
   XP_013596923.1  69 SFSPQEEELIIQCHRIIGSR-WSSIARKLP-GRTDNDVKNHWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129427.406965IPR017930Myb domain
SuperFamilySSF466891.12E-3011108IPR009057Homeodomain-like
SMARTSM007174.9E-161363IPR001005SANT/Myb domain
PfamPF002492.8E-161461IPR001005SANT/Myb domain
CDDcd001674.41E-131761No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2365117IPR009057Homeodomain-like
PROSITE profilePS5129419.29266116IPR017930Myb domain
SMARTSM007175.9E-1566114IPR001005SANT/Myb domain
PfamPF002491.6E-1469110IPR001005SANT/Myb domain
CDDcd001671.51E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGRPPCCDKS NVKKGLWTAE EDAKILAYVA IHGVGNWSLI PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDSF SPQEEELIIQ CHRIIGSRWS SIARKLPGRT DNDVKNHWNT KLKKRLVKMG  120
IDPVTHKPVS QVLTEFRNIS GHGNSSEPFF VRNFKTEPSN NSILTQSNSA WEMMRNATSH  180
ESYHNSPMIF THPTSSEFHF SNHSNFPLNG ATSSCSSSSS SASITQPNQG AQAFCWSDYL  240
LSDPVLPLSS QTQVVGSAAT SNLTLNQNEN FNSHSASSFV DEILDKDQEM LSQFPQLLND  300
FDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1728710.0AC172871.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH006L19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596923.10.0PREDICTED: transcription factor MYB35
SwissprotQ9LSI71e-158MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A078D7B00.0A0A078D7B0_BRANA; BnaC07g25120D protein
TrEMBLA0A0D3DC330.0A0A0D3DC33_BRAOL; Uncharacterized protein
STRINGBra025337.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-153MYB family protein